PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g078120.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 151aa    MW: 17846.8 Da    PI: 9.6677
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g078120.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM146.21.7e-4541311128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGfrFhPtd el+++yLk+k+  kk+ + evi+e++iyk+ P+dLp k ++k+++ ewyfF+++++kya+g + nr+t+ g+Wk tg+d
  Solyc03g078120.2.1   4 LPPGFRFHPTDVELIMYYLKRKIMVKKILF-EVISELNIYKFSPSDLPdKcCYKSKDLEWYFFCPSERKYASGFKMNRTTDIGFWKITGRD 93 
                         79*************************988.99***************6545666777********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++vl  +++ vg  ktLvf++g+ap+ ++tdWv+heyr+
  Solyc03g078120.2.1  94 RRVLY-DEKFVGSVKTLVFHQGKAPRVQRTDWVIHEYRF 131
                         *****.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.02E-492140IPR003441NAC domain
PROSITE profilePS5100546.1174150IPR003441NAC domain
PfamPF023659.6E-245130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MAKLPPGFRF HPTDVELIMY YLKRKIMVKK ILFEVISELN IYKFSPSDLP DKCCYKSKDL  60
EWYFFCPSER KYASGFKMNR TTDIGFWKIT GRDRRVLYDE KFVGSVKTLV FHQGKAPRVQ  120
RTDWVIHEYR FEDKDTADAG FSLPTLNLIH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-41413115140Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.72480.0flower| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2384711e-160Solanum lycopersicum chromosome 3 clone C03HBa0299H10, complete sequence
GenBankAC2468301e-160Solanum lycopersicum strain Heinz 1706 chromosome 3 clone slm-5a16 map 3, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235079.11e-102PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9FY825e-59NAC82_ARATH; NAC domain-containing protein 82
TrEMBLK4BHP21e-110K4BHP2_SOLLC; Uncharacterized protein
STRINGSolyc03g078120.2.11e-109(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.12e-61NAC domain containing protein 103
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]